DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment osp and PLEKHA1

DIOPT Version :9

Sequence 1:NP_001162975.1 Gene:osp / 34850 FlyBaseID:FBgn0003016 Length:1566 Species:Drosophila melanogaster
Sequence 2:XP_011538319.1 Gene:PLEKHA1 / 59338 HGNCID:14335 Length:416 Species:Homo sapiens


Alignment Length:475 Identity:88/475 - (18%)
Similarity:141/475 - (29%) Gaps:164/475 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   406 ERPKSLPLASNSTPAIVSAIVKKIP---------------------------------------- 430
            :.|::||..|:...||....:.|:.                                        
Human    44 DNPQNLPSGSSRVGAIKLTYISKVSDATKLRPKAEFCFVMNAGMRKYFLQANDQQDLVEWVNVLN 108

  Fly   431 -----TVMEQGDKTKPTARLQLHLKSPKHYQHERGDPDGGCNLDELCVNYMAKTDEL-RSVGKAN 489
                 ||.:|.|....:..|..|.:..|.....|.|..||..:  :......:.:|. .|:.:.|
Human   109 KAIKITVPKQSDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPI--ITPTQKEEVNECGESIDRNN 171

  Fly   490 SKSSSGQ-----GKPPVKEESLNAKKGWLMKQDNRTCEWSKHWFTLSGAALFYYRDPLCEERGVL 549
            .|.|...     .|||  ::|...|.|:.:||......|.:.:|.|....:.|::..|.:|...:
Human   172 LKRSQSHLPYFTPKPP--QDSAVIKAGYCVKQGAVMKNWKRRYFQLDENTIGYFKSELEKEPLRV 234

  Fly   550 DGVLDVNSLTSVIPEPAASKQHAFQLTTWDKQRLVLASLSPSSRNSWLAVLRSAAGLPQLDTPPK 614
            ..:.:|:.:..........:.:.|::.|..:...|.|. ||...:||:..:..|           
Human   235 IPLKEVHKVQECKQSDIMMRDNLFEIVTTSRTFYVQAD-SPEEMHSWIKAVSGA----------- 287

  Fly   615 QTDIEQDFIKAQLQQPSSSPVTPGTPAGPHFSSDEEYRTASEGGRRDSLDWGSPLSPSPPVLRSC 679
                    |.||.        .||..|....|.....:|.|.|.|:   .|          .|.|
Human   288 --------IVAQR--------GPGRSASSQSSMRLSAKTVSVGKRK---SW----------RRIC 323

  Fly   680 LRNRSLASLHKRSRSSPPSSRRSTVDSVASDELPLLVVPEEMQPTESRELKQQCETLRAEASLRE 744
            .|                                    ||..:....|.:.|:... .|.||.|.
Human   324 GR------------------------------------PEGCRTLVYRGIHQELVN-AARASPRS 351

  Fly   745 ARMSELLATLQRTEQQLTARLQEQQQQLNSELTQAKQSASDLMHNLGMQLTESQCQIKQLEDRLA 809
            .|:.....:.||:.:.||  .....|||                 .|:.|...:.:|.::.   .
Human   352 FRIQTRFPSYQRSHRHLT--FHSLSQQL-----------------FGLNLYHGEARILRVS---C 394

  Fly   810 QGIEENEGLYKRLRELQAQD 829
            ||         :.||||..|
Human   395 QG---------QARELQGPD 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ospNP_001162975.1 PH_RIP 48..191 CDD:269942
PH 85..185 CDD:278594
PH_M-RIP 509..613 CDD:270094 20/103 (19%)
PH 509..603 CDD:278594 19/93 (20%)
SbcC 726..1353 CDD:223496 24/104 (23%)
PLEKHA1XP_011538319.1 PH1_TAPP1_2 1..117 CDD:270089 9/72 (13%)
PH2_TAPP1_2 185..298 CDD:270090 29/142 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.