DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment osp and dapp1

DIOPT Version :9

Sequence 1:NP_001162975.1 Gene:osp / 34850 FlyBaseID:FBgn0003016 Length:1566 Species:Drosophila melanogaster
Sequence 2:XP_031755425.1 Gene:dapp1 / 548440 XenbaseID:XB-GENE-482064 Length:311 Species:Xenopus tropicalis


Alignment Length:332 Identity:69/332 - (20%)
Similarity:116/332 - (34%) Gaps:92/332 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 VETGEDVDEDEEDETSVPRK---SKTVSMGGQDEN-NRNAGNEITNRVSQPTTCLLIEDIRRDEK 339
            ||..| |:|||| ||.:..:   |...|:|....| :|:|...:.....|..:.||         
 Frog    52 VELAE-VEEDEE-ETELENQTADSGLSSLGWYHANLSRHAAEALLLTNGQDGSYLL--------- 105

  Fly   340 TIKDIANTITNLSQQQNKRWSTAVNNALNNQHHF-----GHHSQYQVTSRDETDFQMSSNSSSTK 399
                      ..|..::..:|.:| .|.::..||     |.:            |:...|...|.
 Frog   106 ----------RNSNSKSNSYSLSV-RARDSVKHFEVLQCGSY------------FKFGFNEFPTL 147

  Fly   400 SQNPASERPKSLPLASNSTPAIVSAIVKKIPTVMEQGDKTKPTARLQLHLKSPKHYQHERGDPDG 464
            .|  ..|...:.||..:.:..::.                         ||.|  |.        
 Frog   148 KQ--FVEHFANQPLIGSESGTLIL-------------------------LKHP--YP-------- 175

  Fly   465 GCNLDELCVNYMAKTDELRSVGKANSKSSSGQGKPPVKEESLNAKKGWLMKQDNRTCEWSKHWFT 529
             |.::|..:....:.......|::.|      ...|| ..:|..|:|:|.||..|...|...||.
 Frog   176 -CTVEEPSIYEAVRVHTAMQTGRSES------DLVPV-APALGTKEGYLTKQGGRVKSWKTRWFI 232

  Fly   530 LSGAALFYYRDPLCEERGVLDGVLDVNSLTSVIPEPAASKQHAFQLTTWDKQRLVLASLSPSSRN 594
            ||...|.|::|.|..|.   ...||:...::|..:.:..|.:.|.: .:..:...|.:.:.:..:
 Frog   233 LSRNELKYFKDKLSTEP---IKTLDLTECSAVQFDYSQEKVNCFCM-VFPLRTYYLCAKTGAEAD 293

  Fly   595 SWLAVLR 601
            .|:.:||
 Frog   294 EWIKMLR 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ospNP_001162975.1 PH_RIP 48..191 CDD:269942
PH 85..185 CDD:278594
PH_M-RIP 509..613 CDD:270094 25/93 (27%)
PH 509..603 CDD:278594 25/93 (27%)
SbcC 726..1353 CDD:223496
dapp1XP_031755425.1 SH2_DAPP1_BAM32_like 73..164 CDD:198218 23/124 (19%)
PH_DAPP1 208..303 CDD:269977 26/97 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.