DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment osp and IPIP

DIOPT Version :9

Sequence 1:NP_001162975.1 Gene:osp / 34850 FlyBaseID:FBgn0003016 Length:1566 Species:Drosophila melanogaster
Sequence 2:NP_001137795.2 Gene:IPIP / 33849 FlyBaseID:FBgn0031768 Length:296 Species:Drosophila melanogaster


Alignment Length:314 Identity:64/314 - (20%)
Similarity:107/314 - (34%) Gaps:86/314 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   499 PPVKEESLNAKKGWLMKQDNRTCEWSKHWFTLSGAALFYY-----RDPLCEERGVLDGVLDVNSL 558
            ||...|....|:|.:.|      .:.:.:|.|.|..|||:     ::||        |::.|...
  Fly    15 PPFDMEGFLNKRGEVNK------AFQRRYFVLKGNLLFYFESRLDKEPL--------GLIIVEGC 65

  Fly   559 TSVIPEPAASKQHAFQLTTWDKQRLVLASLSPSSRNSWLAVLRSAAG-------LPQLDTP-PKQ 615
            |..:....  ..:.|::.....:..:||:.:..|..:|:..| :.||       |.:|... .:.
  Fly    66 TIELSNEV--DNYCFEIAFNGNRTYILAAENQDSMETWMKAL-TCAGYEYKRIILAELKRQLQEM 127

  Fly   616 TDIEQDFIKAQLQQP-----SSSPVTP-------GTPAGPHFSSDEEYRTASEGGRRDSLDWGSP 668
            .|.....:.:.|..|     |:.|..|       ..||.|...|              ||..|..
  Fly   128 EDARNKMLGSALDGPQNASESAKPRPPPRRTNPFNRPAPPPPDS--------------SLRGGVV 178

  Fly   669 LSPSPPV------LRSCLRNRSLASLHKRSRSSPPS-----SRRST-VDSVASDELPLLVVPEEM 721
            :||.|.:      ..:.|:...|.|....:.:..||     .||.| ..::|:.    :..|:..
  Fly   179 MSPLPFINGYFGSSNARLQQEKLMSKQDANGNGSPSGTPRAQRRPTPAPAIANS----VFYPDVR 239

  Fly   722 QP--------------TESRELKQQCETLRAEASLREARMSELLATLQRTEQQL 761
            .|              .:.|::|...|..|.....|...|.::.|..:|..|.|
  Fly   240 DPGAANNNHSTVNGAERQRRQVKALEEFARNHERFRRELMPDVSAYRERQGQPL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ospNP_001162975.1 PH_RIP 48..191 CDD:269942
PH 85..185 CDD:278594
PH_M-RIP 509..613 CDD:270094 24/116 (21%)
PH 509..603 CDD:278594 20/98 (20%)
SbcC 726..1353 CDD:223496 10/36 (28%)
IPIPNP_001137795.2 PH_Ses 11..127 CDD:270105 27/128 (21%)
PH 19..105 CDD:278594 20/101 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.