DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment osp and CYTH4

DIOPT Version :9

Sequence 1:	NP_001162975.1	Gene:	osp / 34850	FlyBaseID:	FBgn0003016	Length:	1566	Species:	Drosophila melanogaster
Sequence 2:	NP_037517.1	Gene:	CYTH4 / 27128	HGNCID:	9505	Length:	394	Species:	Homo sapiens

Alignment Length:	114	Identity:	26/114 - (22%)
Similarity:	49/114 - (42%)	Gaps:	21/114 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   509 KKGWLMKQDNRTCEWSKHWFTLSGAALFYYRDPLCEE-RGVLDGVLDVNSLTSV----------I 562
            ::|||:|...|...|.:.||.|:...|:|:.....:| ||::.  |:..|:..|          :
Human   262 REGWLLKLGGRVKTWKRRWFILTDNCLYYFEFTTDKEPRGIIP--LENLSVQKVDDPKKPFCLEL 324

  Fly   563 PEPAASKQHAFQLTTWDKQRLV--------LASLSPSSRNSWLAVLRSA 603
            ..|:...|......|....|:|        :::.|...|:.|:..:|::
Human   325 YNPSCRGQKIKACKTDGDGRVVEGKHESYRISATSAEERDQWIESIRAS 373

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
osp	NP_001162975.1	PH_RIP	48..191	CDD:269942
		PH	85..185	CDD:278594
		PH_M-RIP	509..613	CDD:270094	26/114 (23%)
		PH	509..603	CDD:278594	26/112 (23%)
		SbcC	726..1353	CDD:223496
CYTH4	NP_037517.1	Sec7	61..243	CDD:279680
		PH_GRP1-like	258..376	CDD:269954	26/114 (23%)
		PH	262..374	CDD:278594	26/114 (23%)
		Phosphatidylinositol 3,4,5-trisphosphate binding. /evidence=ECO:0000250	268..275		2/6 (33%)
		C-terminal autoinhibitory region. /evidence=ECO:0000250	386..394
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910