DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment osp and DAPP1

DIOPT Version :9

Sequence 1:NP_001162975.1 Gene:osp / 34850 FlyBaseID:FBgn0003016 Length:1566 Species:Drosophila melanogaster
Sequence 2:NP_055210.2 Gene:DAPP1 / 27071 HGNCID:16500 Length:280 Species:Homo sapiens


Alignment Length:99 Identity:26/99 - (26%)
Similarity:46/99 - (46%) Gaps:8/99 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   505 SLNAKKGWLMKQDNRTCEWSKHWFTLSGAALFYYRDPLCEE--RGVLDGVLDVNSLTSVIPEPAA 567
            ||..|:|:|.||......|...||||....|.|::|.:..|  |     :||:...::|..:.:.
Human   163 SLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIR-----ILDLTECSAVQFDYSQ 222

  Fly   568 SKQHAFQLTTWDKQRLVLASLSPSSRNSWLAVLR 601
            .:.:.|.| .:..:...|.:.:....:.|:.:||
Human   223 ERVNCFCL-VFPFRTFYLCAKTGVEADEWIKILR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ospNP_001162975.1 PH_RIP 48..191 CDD:269942
PH 85..185 CDD:278594
PH_M-RIP 509..613 CDD:270094 24/95 (25%)
PH 509..603 CDD:278594 24/95 (25%)
SbcC 726..1353 CDD:223496
DAPP1NP_055210.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SH2_DAPP1_BAM32_like 28..119 CDD:198218
PH_DAPP1 163..258 CDD:269977 26/99 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.