DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment osp and IPCEF1

DIOPT Version :9

Sequence 1:NP_001162975.1 Gene:osp / 34850 FlyBaseID:FBgn0003016 Length:1566 Species:Drosophila melanogaster
Sequence 2:NP_001124171.1 Gene:IPCEF1 / 26034 HGNCID:21204 Length:438 Species:Homo sapiens


Alignment Length:405 Identity:93/405 - (22%)
Similarity:154/405 - (38%) Gaps:97/405 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   474 NYMAKTDELRSVGKANSKSSSGQGKPPVKEESLNAK-------KGWLMKQDNR----TCEWSKHW 527
            :|||.......|..........||...:....::.|       :|||.|:..:    :.:|.|.|
Human     3 SYMAIDGSALQVPLRQKPRRKTQGFLTMSRRRISCKDLGHADCQGWLYKKKEKGSFLSNKWKKFW 67

  Fly   528 FTLSGAALFYYRDPLCEERGVLDGVLDVNSLTSVIPEPAASKQHAFQLTTWDKQRLVLASLSPSS 592
            ..|.|::|::|.:.:.|:   .||.:::...| |.......|:|||:::....:....|:.:...
Human    68 VILKGSSLYWYSNQMAEK---ADGFVNLPDFT-VERASECKKKHAFKISHPQIKTFYFAAENVQE 128

  Fly   593 RNSWLAVLRSAA------------------GLPQL--DTPPKQTDIEQDFIKAQLQQPSSSPVTP 637
            .|.||..|.||.                  ..|::  :|||.....:...:.|| |..||||...
Human   129 MNVWLNKLGSAVIHQESTTKDEECYSESEQEDPEIAAETPPPPHASQTQSLTAQ-QASSSSPSLS 192

  Fly   638 GTPAGPHFSS-DEEYRTASE-----GGRRDSL-----------DWGSPL-------SPSPPVLRS 678
            ||...  ||| :...:|.|.     ...|.||           |.|.|:       ||.|     
Human   193 GTSYS--FSSLENTVKTPSSFPSSLSKERQSLPDTVNSLSAAEDEGQPITFAVQVHSPVP----- 250

  Fly   679 CLRNRSLASLHKRSRSSPPSSRRSTVDSVASDELPL-------LVVPE-----EMQPTESRELKQ 731
                 |.|.:||...:|..:|....::|::||:...       |.||:     ::...|..::.:
Human   251 -----SEAGIHKALENSFVTSESGFLNSLSSDDTSSLSSNHDHLTVPDKPAGSKIMDKEETKVSE 310

  Fly   732 QCETLRAEASLREARMSELLATLQRTEQQLTARLQE--QQQQLNSELTQAKQSASDLM---HNLG 791
            ..|..:...||.:|.:|.|......|:::|.....:  :...:|.:|.:.:...|.|.   |:|.
Human   311 DDEMEKLYKSLEQASLSPLGDRRPSTKKELRKSFVKRCKNPSINEKLHKIRTLNSTLKCKEHDLA 375

  Fly   792 MQLTESQCQIKQLED 806
            |        |.||.|
Human   376 M--------INQLLD 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ospNP_001162975.1 PH_RIP 48..191 CDD:269942
PH 85..185 CDD:278594
PH_M-RIP 509..613 CDD:270094 30/134 (22%)
PH 509..603 CDD:278594 26/104 (25%)
SbcC 726..1353 CDD:223496 19/86 (22%)
IPCEF1NP_001124171.1 PH_CNK_mammalian-like 31..144 CDD:269962 28/116 (24%)
PH 45..140 CDD:278594 26/98 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..226 21/84 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 274..308 6/33 (18%)
CRAC domain 316..321 0/4 (0%)
CRAC domain 340..349 1/8 (13%)
Required for interaction with CYTH2. /evidence=ECO:0000269|PubMed:22085542 390..438
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 407..438
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.