DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment osp and PHETA1

DIOPT Version :9

Sequence 1:NP_001162975.1 Gene:osp / 34850 FlyBaseID:FBgn0003016 Length:1566 Species:Drosophila melanogaster
Sequence 2:NP_001171467.1 Gene:PHETA1 / 144717 HGNCID:26509 Length:262 Species:Homo sapiens


Alignment Length:267 Identity:58/267 - (21%)
Similarity:89/267 - (33%) Gaps:79/267 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   497 GKPP--------VKEESL-----------NAKKGWLMKQDNRTCEWSKHWFTLSGAALFYYRDPL 542
            |.||        :.|.||           ||  |:|.|:..|...:.:.||.|.|..|||:.|..
Human     4 GSPPGPAIATMKLNERSLAFYATCDAPVDNA--GFLYKKGGRHAAYHRRWFVLRGNMLFYFEDAA 66

  Fly   543 CEERGVLDGVLDVNSLTSVIPEPAASKQHAFQLTTWDKQRLVLASLSPSSRNSWLAVLRSAAGLP 607
            ..|.   .||:.:...|..:.|.|.....|.:......:..|||:.|..:...|:..|..|:   
Human    67 SREP---VGVIILEGCTVELVEAAEEFAFAVRFAGTRARTYVLAAESQDAMEGWVKALSRAS--- 125

  Fly   608 QLDTPPKQTDIEQDFIKAQLQQPSSSPVTPGTPAGPHFSSDEEYRTASEGGRRDSLDWGSPLS-P 671
                        .|:::..:::.                  |:...|..||...:|....|.| |
Human   126 ------------FDYLRLVVREL------------------EQQLAAVRGGGGMALPQPQPQSLP 160

  Fly   672 SPPVLRSCLRNRSLASLHKRSRSSPPSSRRSTVDSVASDELPLLVVPEEMQPTESRELKQQCETL 736
            .||.|.|.|                     :.|.|:.|...|:..:|...:|:.....:..|...
Human   161 LPPSLPSAL---------------------APVPSLPSAPAPVPALPLPRRPSALPPKENGCAVW 204

  Fly   737 RAEASLR 743
            ..||:.|
Human   205 STEATFR 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ospNP_001162975.1 PH_RIP 48..191 CDD:269942
PH 85..185 CDD:278594
PH_M-RIP 509..613 CDD:270094 26/103 (25%)
PH 509..603 CDD:278594 25/93 (27%)
SbcC 726..1353 CDD:223496 4/18 (22%)
PHETA1NP_001171467.1 PH_Ses 24..143 CDD:270105 30/156 (19%)
PH 35..125 CDD:278594 25/92 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.