DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment osp and AgaP_AGAP008737

DIOPT Version :9

Sequence 1:NP_001162975.1 Gene:osp / 34850 FlyBaseID:FBgn0003016 Length:1566 Species:Drosophila melanogaster
Sequence 2:XP_314852.3 Gene:AgaP_AGAP008737 / 1275590 VectorBaseID:AGAP008737 Length:382 Species:Anopheles gambiae


Alignment Length:70 Identity:24/70 - (34%)
Similarity:35/70 - (50%) Gaps:10/70 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   509 KKGWLMKQDNRTCEWSKHWFTLSGAALFYYRDPLCEE-RGV--LDGVLDVNSLTSVIPEPAASKQ 570
            |:|||.||..|...|.:.||.|:...|:|:.....:| ||:  |:.:. |..:|.      .||.
Mosquito   251 KEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENIA-VREVTD------RSKP 308

  Fly   571 HAFQL 575
            |.|:|
Mosquito   309 HCFEL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ospNP_001162975.1 PH_RIP 48..191 CDD:269942
PH 85..185 CDD:278594
PH_M-RIP 509..613 CDD:270094 24/70 (34%)
PH 509..603 CDD:278594 24/70 (34%)
SbcC 726..1353 CDD:223496
AgaP_AGAP008737XP_314852.3 Sec7 52..232 CDD:279680
PH_GRP1-like 247..365 CDD:269954 24/70 (34%)
PH 251..363 CDD:278594 24/70 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.