powered by:
Protein Alignment osp and AgaP_AGAP008737
DIOPT Version :9
Sequence 1: | NP_001162975.1 |
Gene: | osp / 34850 |
FlyBaseID: | FBgn0003016 |
Length: | 1566 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_314852.3 |
Gene: | AgaP_AGAP008737 / 1275590 |
VectorBaseID: | AGAP008737 |
Length: | 382 |
Species: | Anopheles gambiae |
Alignment Length: | 70 |
Identity: | 24/70 - (34%) |
Similarity: | 35/70 - (50%) |
Gaps: | 10/70 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 509 KKGWLMKQDNRTCEWSKHWFTLSGAALFYYRDPLCEE-RGV--LDGVLDVNSLTSVIPEPAASKQ 570
|:|||.||..|...|.:.||.|:...|:|:.....:| ||: |:.:. |..:|. .||.
Mosquito 251 KEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENIA-VREVTD------RSKP 308
Fly 571 HAFQL 575
|.|:|
Mosquito 309 HCFEL 313
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.