Sequence 1: | NP_001162975.1 | Gene: | osp / 34850 | FlyBaseID: | FBgn0003016 | Length: | 1566 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001120622.1 | Gene: | aldh3b2 / 100145787 | XenbaseID: | XB-GENE-5776192 | Length: | 469 | Species: | Xenopus tropicalis |
Alignment Length: | 275 | Identity: | 58/275 - (21%) |
---|---|---|---|
Similarity: | 92/275 - (33%) | Gaps: | 81/275 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 301 TVSMGGQDENNRNAGNEITN---RVS------QPTTCLLIEDIRRDEKT----IKDIANTITNLS 352
Fly 353 QQQNKRWSTAVNNALNNQHHFGHHSQYQVTSRDETDFQMSSNSSSTKSQNPASER---PKSLPLA 414
Fly 415 SNSTPAIVSAIVKKIPTVMEQG----------DKTKPTARLQLHLKSPKHYQHERGDPDGGCNLD 469
Fly 470 ELCVNYMAKTDELRS----------VGKANSK--------------SSSGQGK------PPVKEE 504
Fly 505 -------SLNAKKGW 512 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
osp | NP_001162975.1 | PH_RIP | 48..191 | CDD:269942 | |
PH | 85..185 | CDD:278594 | |||
PH_M-RIP | 509..613 | CDD:270094 | 4/4 (100%) | ||
PH | 509..603 | CDD:278594 | 4/4 (100%) | ||
SbcC | 726..1353 | CDD:223496 | |||
aldh3b2 | NP_001120622.1 | ALDH_F3AB | 5..447 | CDD:143450 | 53/256 (21%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165164121 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |