DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and Ube2n

DIOPT Version :9

Sequence 1:NP_001285937.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_006514407.1 Gene:Ube2n / 93765 MGIID:1934835 Length:171 Species:Mus musculus


Alignment Length:146 Identity:113/146 - (77%)
Similarity:127/146 - (86%) Gaps:0/146 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PRIIKETQRLLEDPVPGISATPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAPKVR 70
            |...:||||||.:|||||.|.|||.|||||||::.||:|||||||.|||||||||:|||.|||||
Mouse    25 PATAQETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVR 89

  Fly    71 FLTKIFHPNIDRVGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAELWKVNERR 135
            |:|||:|||:|::||||||||||||||||||||||||||||||||||||||||||||.||.||.:
Mouse    90 FMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQ 154

  Fly   136 AIQLARECTLKHAMQN 151
            ||:.||..|..:||.|
Mouse   155 AIETARAWTRLYAMNN 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_001285937.1 UBCc 3..151 CDD:294101 112/144 (78%)
COG5078 7..149 CDD:227410 109/141 (77%)
Ube2nXP_006514407.1 UBCc 29..170 CDD:381827 111/140 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836723
Domainoid 1 1.000 244 1.000 Domainoid score I2193
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H128406
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002236
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1478
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.810

Return to query results.
Submit another query.