DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and UBE2M

DIOPT Version :10

Sequence 1:NP_609715.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_003960.1 Gene:UBE2M / 9040 HGNCID:12491 Length:183 Species:Homo sapiens


Alignment Length:130 Identity:46/130 - (35%)
Similarity:70/130 - (53%) Gaps:6/130 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RIIKETQRLLEDPVPGIS-ATPDE-CNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAPKV 69
            ||.|:...|.......|| :.||: .|.:    ||..|.:..::.|.|.....:.:.||...|||
Human    33 RIQKDINELNLPKTCDISFSDPDDLLNFK----LVICPDEGFYKSGKFVFSFKVGQGYPHDPPKV 93

  Fly    70 RFLTKIFHPNIDRVGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAELWKVNER 134
            :..|.::|||||..|.:||:||::.|.|.|.|.:::..:|.|...|||:|||..:.||:.:.|.|
Human    94 KCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRR 158

  Fly   135  134
            Human   159  158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_609715.1 UBCc_UBE2N 4..147 CDD:467433 46/130 (35%)
UBE2MNP_003960.1 Interaction with UBA3 1..57 8/23 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
UBCc_UBE2F_UBE2M 29..166 CDD:467414 46/130 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.