DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and RAD6

DIOPT Version :9

Sequence 1:NP_001285937.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_011457.1 Gene:RAD6 / 852822 SGDID:S000003026 Length:172 Species:Saccharomyces cerevisiae


Alignment Length:145 Identity:56/145 - (38%)
Similarity:94/145 - (64%) Gaps:3/145 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TP---RIIKETQRLLEDPVPGISATPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKA 66
            ||   |::::.:|:.||..||:||:|...|...::.::.||.|:|:|.|.|:|.|...|:||.|.
Yeast     3 TPARRRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKP 67

  Fly    67 PKVRFLTKIFHPNIDRVGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAELWKV 131
            |.|:||:::||||:...|.||||||:::|:|...:.::|.|||:|.:.|||..|...:.|.|:|.
Yeast    68 PHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKD 132

  Fly   132 NERRAIQLARECTLK 146
            ::.:.::..:|...|
Yeast   133 HKSQYVKRVKETVEK 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_001285937.1 UBCc 3..151 CDD:294101 56/145 (39%)
COG5078 7..149 CDD:227410 54/140 (39%)
RAD6NP_011457.1 COG5078 1..150 CDD:227410 56/145 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.