DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and UBC1

DIOPT Version :10

Sequence 1:NP_609715.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_010462.3 Gene:UBC1 / 851757 SGDID:S000002584 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:123 Identity:53/123 - (43%)
Similarity:81/123 - (65%) Gaps:2/123 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RIIKETQRLLEDPVPGISAT-PDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAPKVR 70
            ||:||.|.:.:||...|:.. ..|.:..:......||..:|:|||.|.:::.:|.:||.|.||::
Yeast     6 RIMKEIQAVKDDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPMEYPFKPPKMQ 70

  Fly    71 FLTKIFHPNIDRV-GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAE 127
            |.||::||||..| |.|||||||:.|||.:.:::.|:|:||||.:|.|:||...:||:
Yeast    71 FDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQ 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_609715.1 UBCc_UBE2N 4..147 CDD:467433 53/123 (43%)
UBC1NP_010462.3 UBCc_UBE2K 4..147 CDD:467420 53/123 (43%)
UBA_3 161..215 CDD:117832
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.