DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and UBC13

DIOPT Version :9

Sequence 1:NP_001285937.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_010377.3 Gene:UBC13 / 851666 SGDID:S000002499 Length:153 Species:Saccharomyces cerevisiae


Alignment Length:148 Identity:102/148 - (68%)
Similarity:123/148 - (83%) Gaps:0/148 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAALTPRIIKETQRLLEDPVPGISATPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMK 65
            ||:|..||||||::|:.||||||:|.|.:.|.|||.|.:.||:.||:|.|.|:|||:||:||||:
Yeast     1 MASLPKRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPME 65

  Fly    66 APKVRFLTKIFHPNIDRVGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAELWK 130
            ||||||||||:||||||:||||||:||..||||||||||||||||||::|||:|||||||||.|.
Yeast    66 APKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWI 130

  Fly   131 VNERRAIQLARECTLKHA 148
            .||:.|...|||.|..:|
Yeast   131 KNEQGAKAKAREWTKLYA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_001285937.1 UBCc 3..151 CDD:294101 100/146 (68%)
COG5078 7..149 CDD:227410 99/142 (70%)
UBC13NP_010377.3 UBCc 3..152 CDD:412187 100/146 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 211 1.000 Domainoid score I501
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 225 1.000 Inparanoid score I754
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoFinder 1 1.000 - - FOG0002236
OrthoInspector 1 1.000 - - otm46686
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1478
TreeFam 1 0.960 - -
1110.930

Return to query results.
Submit another query.