DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and UBC35

DIOPT Version :9

Sequence 1:NP_001285937.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_565192.1 Gene:UBC35 / 844224 AraportID:AT1G78870 Length:153 Species:Arabidopsis thaliana


Alignment Length:145 Identity:106/145 - (73%)
Similarity:123/145 - (84%) Gaps:0/145 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTPRIIKETQRLLEDPVPGISATPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAPK 68
            |..||||||||||.:|.|||||:|.|.|.|||:|::.||..||:|||.|||||||||:|||.|||
plant     6 LPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPK 70

  Fly    69 VRFLTKIFHPNIDRVGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAELWKVNE 133
            |||||||:|||||::||||||||||||||||||||||||||||||||||||||:.::|:.||.||
plant    71 VRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKSNE 135

  Fly   134 RRAIQLARECTLKHA 148
            ..|:..|:|.|..:|
plant   136 AEAVDTAKEWTRLYA 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_001285937.1 UBCc 3..151 CDD:294101 106/145 (73%)
COG5078 7..149 CDD:227410 105/142 (74%)
UBC35NP_565192.1 UBCc 6..150 CDD:412187 105/143 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 232 1.000 Domainoid score I644
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 245 1.000 Inparanoid score I1055
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1345547at2759
OrthoFinder 1 1.000 - - FOG0002236
OrthoInspector 1 1.000 - - mtm1183
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1478
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.940

Return to query results.
Submit another query.