DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and UBC28

DIOPT Version :10

Sequence 1:NP_609715.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001154446.1 Gene:UBC28 / 842728 AraportID:AT1G64230 Length:190 Species:Arabidopsis thaliana


Alignment Length:185 Identity:73/185 - (39%)
Similarity:97/185 - (52%) Gaps:42/185 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RIIKETQRLLEDPVPGISATP-----------DECNARY-----------------FHVL----- 38
            ||:||.:.|.:||....||..           ::|..|:                 .|||     
plant     5 RILKELKDLQKDPPTSCSAVDNASKLLVLIELEDCCRRFSNCSCILLLEKSQDIAMAHVLLCPVA 69

  Fly    39 ---------VTGPKDSPFEGGNFKLELFLPEDYPMKAPKVRFLTKIFHPNIDRVGRICLDILKDK 94
                     :.||.|||:.||.|.:.:..|.|||.|.|||.|.||:||||::..|.|||||||::
plant    70 EDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNVNSNGSICLDILKEQ 134

  Fly    95 WSPALQIRTVLLSIQALLSAPNPDDPLANDVAELWKVNERRAIQLARECTLKHAM 149
            |||||.|..|||||.:||:.|||||||..::|.::|.:..:....||..|.|:||
plant   135 WSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESTARSWTQKYAM 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_609715.1 UBCc_UBE2N 4..147 CDD:467433 70/181 (39%)
UBC28NP_001154446.1 UBCc_UBE2D 3..187 CDD:467412 70/181 (39%)

Return to query results.
Submit another query.