DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and UBC31

DIOPT Version :10

Sequence 1:NP_609715.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_564472.1 Gene:UBC31 / 840541 AraportID:AT1G36340 Length:154 Species:Arabidopsis thaliana


Alignment Length:111 Identity:58/111 - (52%)
Similarity:75/111 - (67%) Gaps:0/111 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LVTGPKDSPFEGGNFKLELFLPEDYPMKAPKVRFLTKIFHPNIDRVGRICLDILKDKWSPALQIR 102
            ::.||..:|:|||.|.|.:..|.|||.|.||..|.|.|:||||:..|.||::||||||:|||.:.
plant    42 VIRGPDGTPYEGGMFNLSIKFPTDYPFKPPKFTFKTPIYHPNINDEGSICMNILKDKWTPALMVE 106

  Fly   103 TVLLSIQALLSAPNPDDPLANDVAELWKVNERRAIQLARECTLKHA 148
            .|||||..||..|||||||..::.:|:|.|..:..|.|||.|.:||
plant   107 KVLLSILLLLEKPNPDDPLVPEIGQLFKNNRFQFDQRAREFTARHA 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_609715.1 UBCc_UBE2N 4..147 CDD:467433 56/108 (52%)
UBC31NP_564472.1 UBCc_UEV 28..151 CDD:483950 56/108 (52%)

Return to query results.
Submit another query.