DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and UBC30

DIOPT Version :10

Sequence 1:NP_609715.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_851198.1 Gene:UBC30 / 835714 AraportID:AT5G56150 Length:148 Species:Arabidopsis thaliana


Alignment Length:143 Identity:68/143 - (47%)
Similarity:90/143 - (62%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RIIKETQRLLEDPVPGISATPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAPKVRF 71
            ||.||.:.|..||....||.|...:...:...:.||.||||.||.|.:.:..|.|||.|.|||.|
plant     5 RINKELRDLQRDPPVSCSAGPTGDDMFQWQATIMGPADSPFAGGVFLVTIHFPPDYPFKPPKVAF 69

  Fly    72 LTKIFHPNIDRVGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAELWKVNERRA 136
            .||::||||:..|.|||||||::|||||.:..|||||.:||:.|||||||..::|.::|.:..:.
plant    70 RTKVYHPNINSNGSICLDILKEQWSPALTVSKVLLSICSLLTDPNPDDPLVPEIAHIYKTDRVKY 134

  Fly   137 IQLARECTLKHAM 149
            ...|:..|.|:||
plant   135 ESTAQSWTQKYAM 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_609715.1 UBCc_UBE2N 4..147 CDD:467433 65/139 (47%)
UBC30NP_851198.1 UBCc_UBE2D 3..145 CDD:467412 65/139 (47%)

Return to query results.
Submit another query.