DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and UBC27

DIOPT Version :10

Sequence 1:NP_609715.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001190508.1 Gene:UBC27 / 835159 AraportID:AT5G50870 Length:203 Species:Arabidopsis thaliana


Alignment Length:135 Identity:61/135 - (45%)
Similarity:82/135 - (60%) Gaps:6/135 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RIIKETQRL-LEDPVPGISATPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAPKVR 70
            ||.||.|.. ......||...|...|.......:.||..:|:|||.|::::.:|:.||.:.||::
plant     6 RIQKELQDCERNQDSSGIRVCPKSDNLTRLTGTIPGPIGTPYEGGTFQIDITMPDGYPFEPPKMQ 70

  Fly    71 FLTKIFHPNI-DRVGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDP----LANDVAELWK 130
            |.||::|||| .:.|.||||||||:|||||.::|.|:|||||||||.|.||    :|..|..|..
plant    71 FSTKVWHPNISSQSGAICLDILKDQWSPALTLKTALVSIQALLSAPEPKDPQDAVVAEQVLLLHH 135

  Fly   131 VNERR 135
            :|..|
plant   136 LNHLR 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_609715.1 UBCc_UBE2N 4..147 CDD:467433 61/135 (45%)
UBC27NP_001190508.1 UBCc_UBE2K 4..158 CDD:467420 61/135 (45%)
UBA_II_E2_UBC27_like 166..201 CDD:270497
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.