DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and UBC12

DIOPT Version :10

Sequence 1:NP_609715.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_566332.1 Gene:UBC12 / 820017 AraportID:AT3G08700 Length:149 Species:Arabidopsis thaliana


Alignment Length:144 Identity:65/144 - (45%)
Similarity:91/144 - (63%) Gaps:1/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RIIKETQRLLEDPVPGISATP-DECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAPKVR 70
            ||.:|.:.:...|....||.| .|.:..::...:.||.|||:.||.|.:.:....|||.|.|||.
plant     5 RISRELRDMQRHPPANCSAGPVAEEDIFHWQATIMGPHDSPYSGGVFTVSIDFSSDYPFKPPKVN 69

  Fly    71 FLTKIFHPNIDRVGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAELWKVNERR 135
            |.||::|||||..|.|||||||::||||.....|||||.:||:.|||:|||..::|.|:||::.:
plant    70 FKTKVYHPNIDSKGSICLDILKEQWSPAPTTSKVLLSICSLLTDPNPNDPLVPEIAHLYKVDKSK 134

  Fly   136 AIQLARECTLKHAM 149
            ....|::.|.|:||
plant   135 YESTAQKWTQKYAM 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_609715.1 UBCc_UBE2N 4..147 CDD:467433 62/140 (44%)
UBC12NP_566332.1 UBCc_UBE2D 3..146 CDD:467412 62/140 (44%)

Return to query results.
Submit another query.