DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and UBC29

DIOPT Version :10

Sequence 1:NP_609715.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_565391.1 Gene:UBC29 / 816175 AraportID:AT2G16740 Length:148 Species:Arabidopsis thaliana


Alignment Length:145 Identity:70/145 - (48%)
Similarity:95/145 - (65%) Gaps:0/145 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TPRIIKETQRLLEDPVPGISATPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAPKV 69
            |.||:||.:.|..||....||.|...:..::...:.||.:||:.||.|.:.:..|.|||.|.|||
plant     3 TRRILKELKELQRDPPVSCSAGPTGEDMFHWQATIMGPNESPYSGGVFLVNIHFPPDYPFKPPKV 67

  Fly    70 RFLTKIFHPNIDRVGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAELWKVNER 134
            .|.||:|||||:..|.||||||||:|||||.|..|||||.:||:.|||||||..::|.::|.::.
plant    68 VFRTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHIYKTDKT 132

  Fly   135 RAIQLARECTLKHAM 149
            :...:||..|.|:|:
plant   133 KYEAMARSWTQKYAL 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_609715.1 UBCc_UBE2N 4..147 CDD:467433 68/141 (48%)
UBC29NP_565391.1 UBCc_UBE2D 3..145 CDD:467412 68/141 (48%)

Return to query results.
Submit another query.