DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and UBE2N

DIOPT Version :9

Sequence 1:NP_001285937.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_003339.1 Gene:UBE2N / 7334 HGNCID:12492 Length:152 Species:Homo sapiens


Alignment Length:151 Identity:119/151 - (78%)
Similarity:132/151 - (87%) Gaps:0/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAALTPRIIKETQRLLEDPVPGISATPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMK 65
            ||.|..||||||||||.:|||||.|.|||.|||||||::.||:|||||||.|||||||||:|||.
Human     1 MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMA 65

  Fly    66 APKVRFLTKIFHPNIDRVGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAELWK 130
            ||||||:|||:|||:|::||||||||||||||||||||||||||||||||||||||||||||.||
Human    66 APKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWK 130

  Fly   131 VNERRAIQLARECTLKHAMQN 151
            .||.:||:.||..|..:||.|
Human   131 TNEAQAIETARAWTRLYAMNN 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_001285937.1 UBCc 3..151 CDD:294101 116/147 (79%)
COG5078 7..149 CDD:227410 113/141 (80%)
UBE2NNP_003339.1 UBCc 4..151 CDD:412187 116/146 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146767
Domainoid 1 1.000 244 1.000 Domainoid score I2199
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H128406
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1345547at2759
OrthoFinder 1 1.000 - - FOG0002236
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1478
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.820

Return to query results.
Submit another query.