DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and Ube2r2

DIOPT Version :9

Sequence 1:NP_001285937.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_080551.1 Gene:Ube2r2 / 67615 MGIID:1914865 Length:238 Species:Mus musculus


Alignment Length:144 Identity:49/144 - (34%)
Similarity:77/144 - (53%) Gaps:14/144 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAALTPRIIKETQRLLEDPVPGISAT-PDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPM 64
            |.:....::.|.:.|.|:||.|...| .||.:...:.|.:.||.::.:|||.||..:..|.|||.
Mouse     6 MTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPY 70

  Fly    65 KAPKVRFLTKIFHPNIDRVGRICLDIL-------------KDKWSPALQIRTVLLSIQALLSAPN 116
            ..|..|||||::||||...|.:|:.||             .::|:|...:||:|||:.:||:.||
Mouse    71 SPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPN 135

  Fly   117 PDDPLANDVAELWK 130
            ...|...|.:.:::
Mouse   136 TFSPANVDASVMFR 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_001285937.1 UBCc 3..151 CDD:294101 48/142 (34%)
COG5078 7..149 CDD:227410 48/138 (35%)
Ube2r2NP_080551.1 UBCc 11..169 CDD:238117 48/139 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..238
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.