DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and UBE2D4

DIOPT Version :10

Sequence 1:NP_609715.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_024302563.1 Gene:UBE2D4 / 51619 HGNCID:21647 Length:192 Species:Homo sapiens


Alignment Length:139 Identity:68/139 - (48%)
Similarity:88/139 - (63%) Gaps:0/139 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ETQRLLEDPVPGISATPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAPKVRFLTKI 75
            |...|..||....||.|...:..::...:.||.|||::||.|.|.:..|.|||.|.|||.|.|||
Human    54 ELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKI 118

  Fly    76 FHPNIDRVGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAELWKVNERRAIQLA 140
            :||||:..|.||||||:.:|||||.:..|||||.:||..|||||||..::|..:|.:..:..:||
Human   119 YHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLA 183

  Fly   141 RECTLKHAM 149
            ||.|.|:||
Human   184 REWTQKYAM 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_609715.1 UBCc_UBE2N 4..147 CDD:467433 65/135 (48%)
UBE2D4XP_024302563.1 UBCc_UBE2D 54..190 CDD:467412 65/135 (48%)

Return to query results.
Submit another query.