DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and ube2f

DIOPT Version :10

Sequence 1:NP_609715.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001011221.1 Gene:ube2f / 496657 XenbaseID:XB-GENE-960076 Length:185 Species:Xenopus tropicalis


Alignment Length:137 Identity:47/137 - (34%)
Similarity:72/137 - (52%) Gaps:17/137 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RIIKETQRLLEDPVPGISAT---------PDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDY 62
            |.:....|||...|..:.|.         ||.....|||:.|: |.:|.::||.|:.|:.:|:.|
 Frog    28 RRVSVRDRLLVKEVAELEANLPCTCKVNFPDPNKLHYFHLTVS-PDESYYQGGRFQFEIEVPDAY 91

  Fly    63 PMKAPKVRFLTKIFHPNIDRVGRICLDILKDK------WSPALQIRTVLLSIQALLS-APNPDDP 120
            .|..|||:.||:|:||||...|.|||.:|::.      |:|...::.|:..:.:|.: ..|.|||
 Frog    92 NMVPPKVKCLTRIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDP 156

  Fly   121 LANDVAE 127
            |..:.||
 Frog   157 LNIEAAE 163

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_609715.1 UBCc_UBE2N 4..147 CDD:467433 47/137 (34%)