DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and vih

DIOPT Version :9

Sequence 1:NP_001285937.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_648582.1 Gene:vih / 44118 FlyBaseID:FBgn0264848 Length:178 Species:Drosophila melanogaster


Alignment Length:133 Identity:59/133 - (44%)
Similarity:81/133 - (60%) Gaps:2/133 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ALTPRIIKETQRLLEDPVPGISATPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAP 67
            |::.|:.||...|:.....||||.||..|...:...:.||:::.:.|..::|.|..|..||..||
  Fly    32 AVSKRLHKELMNLMMANERGISAFPDGENIFKWVGTIAGPRNTVYSGQTYRLSLDFPNSYPYAAP 96

  Fly    68 KVRFLTKIFHPNIDRVGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAELWKVN 132
            .|:|||..||||:|..|.|||||||||||....:||:|||||:||..||.:.||....|.:|  |
  Fly    97 VVKFLTSCFHPNVDLQGAICLDILKDKWSALYDVRTILLSIQSLLGEPNNESPLNAQAAMMW--N 159

  Fly   133 ERR 135
            :::
  Fly   160 DQK 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_001285937.1 UBCc 3..151 CDD:294101 59/133 (44%)
COG5078 7..149 CDD:227410 58/129 (45%)
vihNP_648582.1 COG5078 31..166 CDD:227410 59/133 (44%)
UQ_con 36..172 CDD:278603 58/129 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438028
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.