DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and CG5823

DIOPT Version :10

Sequence 1:NP_609715.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_650631.1 Gene:CG5823 / 42105 FlyBaseID:FBgn0038515 Length:283 Species:Drosophila melanogaster


Alignment Length:116 Identity:38/116 - (32%)
Similarity:57/116 - (49%) Gaps:9/116 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RIIKETQRLLEDPVPGISATPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAPKVRF 71
            |:.::..||..||:|.|:|.|...|...:|..|.||:|||:.||.:...|..|.::|.|.|.:..
  Fly    18 RMKQDYMRLKRDPLPYITAEPLPNNILEWHYCVKGPEDSPYYGGYYHGTLLFPREFPFKPPSIYM 82

  Fly    72 LTKIFHPN--IDRVGRICL---DILKDKWSPALQIRTVLLSIQALLSAPNP 117
            ||    ||  .....|:||   |...|.|:|...:.|:|..:.:.:....|
  Fly    83 LT----PNGRFKTNTRLCLSISDFHPDTWNPTWCVGTILTGLLSFMLESTP 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_609715.1 UBCc_UBE2N 4..147 CDD:467433 38/116 (33%)
CG5823NP_650631.1 UBCc_UBE2J 18..149 CDD:467419 38/116 (33%)

Return to query results.
Submit another query.