DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and Ubc84D

DIOPT Version :10

Sequence 1:NP_609715.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster


Alignment Length:149 Identity:50/149 - (33%)
Similarity:83/149 - (55%) Gaps:5/149 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ALTPRIIKETQRLLEDPVPGIS--ATPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMK 65
            |.|.|:.:|...|:|..:..:.  .:.||....:..:||  |:.:|:..|.|::|:..|..||..
  Fly     2 AATRRLTRELSDLVEAKMSTLRNIESSDESLLMWTGLLV--PEKAPYNKGAFRIEINFPPQYPFM 64

  Fly    66 APKVRFLTKIFHPNIDRVGRICLDILK-DKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAELW 129
            .||:.|.|||:|||:|..|.:||.|:. |.|.|..:...||.::.|::..|.|:.||.:|:||.:
  Fly    65 PPKILFKTKIYHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQALVAIVHNPEPEHPLRSDLAEEF 129

  Fly   130 KVNERRAIQLARECTLKHA 148
            ....::.::.|.|.|.|:|
  Fly   130 VREHKKFMKTAEEFTKKNA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_609715.1 UBCc_UBE2N 4..147 CDD:467433 47/145 (32%)
Ubc84DNP_524260.1 UBCc_UBE2L3 3..149 CDD:467421 49/148 (33%)

Return to query results.
Submit another query.