DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and CG7656

DIOPT Version :9

Sequence 1:NP_001285937.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster


Alignment Length:135 Identity:46/135 - (34%)
Similarity:74/135 - (54%) Gaps:16/135 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ETQRLLEDPVPG--ISATPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAPKVRFLT 73
            |.:.|.|:||.|  :....|: |...:.|.:.||.|:.::||.||..:..|.|||...|.:||||
  Fly    48 EYKSLQEEPVEGFRVKLINDD-NLFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYPYSPPSIRFLT 111

  Fly    74 KIFHPNIDRVGRICLDILK-------------DKWSPALQIRTVLLSIQALLSAPNPDDPLANDV 125
            |::|||:...|.:|:.||.             ::|:|...:||:|||:.:||:.||...|...|.
  Fly   112 KVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISLLNEPNTFSPANVDA 176

  Fly   126 AELWK 130
            :.:::
  Fly   177 SVMYR 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_001285937.1 UBCc 3..151 CDD:294101 46/135 (34%)
COG5078 7..149 CDD:227410 46/135 (34%)
CG7656NP_648783.4 UBCc 42..186 CDD:238117 46/135 (34%)
COG5078 45..182 CDD:227410 46/135 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438128
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.