DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and ube2m

DIOPT Version :10

Sequence 1:NP_609715.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_988956.1 Gene:ube2m / 394553 XenbaseID:XB-GENE-1005525 Length:183 Species:Xenopus tropicalis


Alignment Length:97 Identity:38/97 - (39%)
Similarity:58/97 - (59%) Gaps:0/97 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LVTGPKDSPFEGGNFKLELFLPEDYPMKAPKVRFLTKIFHPNIDRVGRICLDILKDKWSPALQIR 102
            ||..|.:..::||.|.....:.:.||...|||:..|.::|||||..|.:||:||::.|.|.|.|.
 Frog    62 LVICPDEGFYKGGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTIN 126

  Fly   103 TVLLSIQALLSAPNPDDPLANDVAELWKVNER 134
            :::..:|.|...|||:|||..:.||:.:.|.|
 Frog   127 SIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRR 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_609715.1 UBCc_UBE2N 4..147 CDD:467433 38/97 (39%)
ube2mNP_988956.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
UBCc_UBE2F_UBE2M 29..166 CDD:467414 38/97 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.