DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and UBE2NL

DIOPT Version :9

Sequence 1:NP_001285937.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001013007.1 Gene:UBE2NL / 389898 HGNCID:31710 Length:153 Species:Homo sapiens


Alignment Length:152 Identity:111/152 - (73%)
Similarity:125/152 - (82%) Gaps:1/152 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAALTPRIIKETQRLLEDPVPGISATPDECNARYFHVLVTG-PKDSPFEGGNFKLELFLPEDYPM 64
            ||.|..||||||||||.:|||||.|.|||.|||||||::.| .||||||||.||.||.|.|:|||
Human     1 MAELPHRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGESKDSPFEGGTFKRELLLAEEYPM 65

  Fly    65 KAPKVRFLTKIFHPNIDRVGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAELW 129
            .||||||:|||:|||:|::.||.|||||||||||||||||||||||||:||||||||||||.|.|
Human    66 AAPKVRFMTKIYHPNVDKLERISLDILKDKWSPALQIRTVLLSIQALLNAPNPDDPLANDVVEQW 130

  Fly   130 KVNERRAIQLARECTLKHAMQN 151
            |.||.:||:.||..|..:||.:
Human   131 KTNEAQAIETARAWTRLYAMNS 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_001285937.1 UBCc 3..151 CDD:294101 109/148 (74%)
COG5078 7..149 CDD:227410 106/142 (75%)
UBE2NLNP_001013007.1 UBCc 4..152 CDD:294101 109/147 (74%)
COG5078 7..151 CDD:227410 107/143 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146765
Domainoid 1 1.000 244 1.000 Domainoid score I2199
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002236
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1478
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.