DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and CG7220

DIOPT Version :10

Sequence 1:NP_609715.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_724964.2 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster


Alignment Length:112 Identity:39/112 - (34%)
Similarity:67/112 - (59%) Gaps:4/112 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RIIKETQRLLEDPVPGISATPD--ECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAPKV 69
            |:.||...|:::|.||::...:  :.|...:.:.:.|.:.:.:||.:|:|.......||..:|:|
  Fly    46 RLHKELMSLIKEPPPGVTIDTESVQQNLSEWKINIKGFEGTLYEGEDFQLLFKFNNKYPFDSPEV 110

  Fly    70 RFL-TKI-FHPNIDRVGRICLDILKDKWSPALQIRTVLLSIQALLSA 114
            .|: |.| .||::...|.|||.||.:.|||||.:::|.|||.::||:
  Fly   111 TFIGTNIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIASMLSS 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_609715.1 UBCc_UBE2N 4..147 CDD:467433 39/112 (35%)
CG7220NP_724964.2 UBCc_UBE2W 44..164 CDD:467428 39/112 (35%)

Return to query results.
Submit another query.