DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and CG4502

DIOPT Version :10

Sequence 1:NP_609715.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_609103.1 Gene:CG4502 / 34002 FlyBaseID:FBgn0031896 Length:306 Species:Drosophila melanogaster


Alignment Length:124 Identity:30/124 - (24%)
Similarity:53/124 - (42%) Gaps:23/124 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TPRIIKETQRL-----LEDPVPGISATPDECNARYFHVLVTGPKDSPF-----EGG--NFKLELF 57
            |.|::||.:.:     ..|.|..:....|.....:..:.|..| |||.     |.|  ...|.|.
  Fly   140 TRRLMKEYREMERLQAKNDAVFTVELVNDSLFEWHVRLHVIDP-DSPLARDMAEMGVPAILLHLS 203

  Fly    58 LPEDYPMKAPKVRFLTKIFHPNIDR-----VGRICLDILKDK-WSPALQIRTVLLSIQA 110
            .|:::|...|.:|    :..|:|::     .|.||:::|..: |:.|..:..|::...|
  Fly   204 FPDNFPFAPPFMR----VVEPHIEKGYVMEGGAICMELLTPRGWASAYTVEAVIMQFAA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_609715.1 UBCc_UBE2N 4..147 CDD:467433 30/124 (24%)
CG4502NP_609103.1 UBCc_UBE2Q 141..293 CDD:467422 29/123 (24%)

Return to query results.
Submit another query.