DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and morgue

DIOPT Version :9

Sequence 1:NP_001285937.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_608833.1 Gene:morgue / 33648 FlyBaseID:FBgn0027609 Length:491 Species:Drosophila melanogaster


Alignment Length:129 Identity:55/129 - (42%)
Similarity:77/129 - (59%) Gaps:1/129 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GISATPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAPKVRFLTKIFHPNIDRVGRI 86
            ||||.|.:....|:...:.||..||:|||.|.|.::.||.|||..|.|||||||.|||:.|.|.:
  Fly   356 GISAIPLDRQNNYWQATILGPPGSPYEGGKFFLFIYFPERYPMTPPTVRFLTKILHPNVSRHGDV 420

  Fly    87 CLDILKD-KWSPALQIRTVLLSIQALLSAPNPDDPLANDVAELWKVNERRAIQLARECTLKHAM 149
            .:||.:. .||.||.:..||||:|:||:.|..:..:..::..:::....|..||.|..|.|:||
  Fly   421 GIDIFQQHNWSLALNVAKVLLSVQSLLTDPYTEVCMEPELGYIYEHERERFEQLVRAWTWKYAM 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_001285937.1 UBCc 3..151 CDD:294101 55/129 (43%)
COG5078 7..149 CDD:227410 53/127 (42%)
morgueNP_608833.1 DUF3664 92..190 CDD:289191
F-box-like 234..275 CDD:289689
UQ_con 342..479 CDD:278603 51/122 (42%)
COG5078 355..485 CDD:227410 55/129 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.