DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and CG40045

DIOPT Version :9

Sequence 1:NP_001285937.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster


Alignment Length:157 Identity:51/157 - (32%)
Similarity:91/157 - (57%) Gaps:22/157 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KETQRLLEDPVPGISA-TPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAPKVRFLT 73
            |:...|.::||.|.|| ..||.:...:.||:.||.|:.:|||.||..|:.|::||::.|:::|:|
  Fly    12 KQLAELNKNPVEGFSAGLIDENDIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEYPLRPPRMKFVT 76

  Fly    74 KIFHPNIDRVGRICLDIL-------------KDKWSPALQIRTVLLSIQALLSAPNPDDPLANDV 125
            :|:||||::.|.:|:.||             .::|.|...:.|:|:|:.::|:.||.:.|...|.
  Fly    77 EIWHPNIEKNGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISVISMLADPNDESPANVDA 141

  Fly   126 AELWKVN----ERRAIQLAR----ECT 144
            |:.|:.:    :|:..:..|    ||:
  Fly   142 AKEWRESYTDFKRKVARCVRKSQEECS 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_001285937.1 UBCc 3..151 CDD:294101 51/157 (32%)
COG5078 7..149 CDD:227410 51/157 (32%)
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 48/147 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438080
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.