DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and UBE2K

DIOPT Version :10

Sequence 1:NP_609715.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_005330.1 Gene:UBE2K / 3093 HGNCID:4914 Length:200 Species:Homo sapiens


Alignment Length:104 Identity:59/104 - (56%)
Similarity:75/104 - (72%) Gaps:1/104 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VTGPKDSPFEGGNFKLELFLPEDYPMKAPKVRFLTKIFHPNIDRV-GRICLDILKDKWSPALQIR 102
            :.||.|:|:|||.::||:.:||.||...|||||:|||:||||..| |.||||||||:|:.|:.:|
Human    43 IAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLR 107

  Fly   103 TVLLSIQALLSAPNPDDPLANDVAELWKVNERRAIQLAR 141
            |||||:||||:|..||||....||..:|.|.....|.||
Human   108 TVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTAR 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_609715.1 UBCc_UBE2N 4..147 CDD:467433 59/104 (57%)
UBE2KNP_005330.1 UBCc_UBE2K 6..151 CDD:467420 59/104 (57%)
UBA_II_E2_UBE2K 163..200 CDD:270573
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.