DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and Ube2o

DIOPT Version :9

Sequence 1:NP_001285937.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_221132.5 Gene:Ube2o / 303689 RGDID:1310297 Length:1291 Species:Rattus norvegicus


Alignment Length:120 Identity:32/120 - (26%)
Similarity:57/120 - (47%) Gaps:11/120 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IKETQRLLEDPVP-GISATPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAPKVRFL 72
            :::...||...:| ||.....|.....|..|:.||..:|:|.|.:..::.||..||...|...:|
  Rat   958 VRKEMALLATSLPDGIMVKTFEDRMDLFSALIKGPTRTPYEDGLYLFDIQLPNIYPAVPPHFCYL 1022

  Fly    73 TKI---FHPNIDRVGRICLDIL-------KDKWSPALQIRTVLLSIQALLSAPNP 117
            ::.   .:||:...|::|:.:|       .::|:....:..||:|||.|:....|
  Rat  1023 SQCSGRLNPNLYDNGKVCVSLLGTWIGKGTERWTSKSSLLQVLISIQGLILVNEP 1077

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_001285937.1 UBCc 3..151 CDD:294101 32/120 (27%)
COG5078 7..149 CDD:227410 32/120 (27%)
Ube2oXP_221132.5 UBCc 958..1108 CDD:238117 32/120 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.