DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and UBE2T

DIOPT Version :10

Sequence 1:NP_609715.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_054895.1 Gene:UBE2T / 29089 HGNCID:25009 Length:197 Species:Homo sapiens


Alignment Length:148 Identity:68/148 - (45%)
Similarity:93/148 - (62%) Gaps:4/148 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RIIKETQRLLEDPVPGISATPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAPKVRF 71
            |:.:|...|..:|.|||:...|:.........:.|..::|:|.|.||||:.:||.||.:.|::||
Human     6 RLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRF 70

  Fly    72 LTKIFHPNIDRVGRICLDIL----KDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAELWKVN 132
            ||.|:|||||..||||||:|    |..|.|:|.|.|||.|||.|:|.|||||||..|::..:|.|
Human    71 LTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYN 135

  Fly   133 ERRAIQLARECTLKHAMQ 150
            :...::.||:.|.|||.|
Human   136 KPAFLKNARQWTEKHARQ 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_609715.1 UBCc_UBE2N 4..147 CDD:467433 64/143 (45%)
UBE2TNP_054895.1 UBCc_UBE2T 5..150 CDD:467425 64/143 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..197 4/5 (80%)

Return to query results.
Submit another query.