DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and Ube2z

DIOPT Version :9

Sequence 1:NP_001285937.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_758504.3 Gene:Ube2z / 268470 MGIID:1343160 Length:356 Species:Mus musculus


Alignment Length:127 Identity:47/127 - (37%)
Similarity:72/127 - (56%) Gaps:13/127 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RIIKETQRLLEDPVPGISATPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAPKVRF 71
            ||.::...:.::|.||:...||..:....|.|:|||.|:|:|||.|......|.|||:..|:|:.
Mouse   105 RIKRDIMSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKL 169

  Fly    72 LTK-----IFHPNIDRVGRICLDIL----KDKWSPALQIRTVLLSIQALLSAPNPDDPLAND 124
            :|.     .|:||..|.|::||.||    ...||||..|.:||:|||:|::    ::|..|:
Mouse   170 MTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMT----ENPYHNE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_001285937.1 UBCc 3..151 CDD:294101 47/127 (37%)
COG5078 7..149 CDD:227410 47/127 (37%)
Ube2zNP_758504.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
UBCc 105..223 CDD:238117 45/121 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 334..356
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2972
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.