DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and ubc13

DIOPT Version :9

Sequence 1:NP_001285937.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_594929.1 Gene:ubc13 / 2542925 PomBaseID:SPAC11E3.04c Length:148 Species:Schizosaccharomyces pombe


Alignment Length:147 Identity:96/147 - (65%)
Similarity:113/147 - (76%) Gaps:0/147 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ALTPRIIKETQRLLEDPVPGISATPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAP 67
            ||..|||||.:.|..||.|||.|.|.|.|.|||.:.:.||:.|.:|||.|.||||||::|||..|
pombe     2 ALPKRIIKEIETLTRDPPPGIVAAPTEDNLRYFKITMEGPQQSAYEGGKFHLELFLPDEYPMMPP 66

  Fly    68 KVRFLTKIFHPNIDRVGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAELWKVN 132
            .|||||||:|||:|::|||||..||..|||||||||||||||||:.||||||||.||||::||.|
pombe    67 NVRFLTKIYHPNVDKLGRICLSTLKKDWSPALQIRTVLLSIQALMGAPNPDDPLDNDVAKIWKEN 131

  Fly   133 ERRAIQLARECTLKHAM 149
            |.:||..|||.|.|:|:
pombe   132 EPQAIANAREWTKKYAV 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_001285937.1 UBCc 3..151 CDD:294101 96/147 (65%)
COG5078 7..149 CDD:227410 93/141 (66%)
ubc13NP_594929.1 UBCc 1..148 CDD:294101 95/145 (66%)
COG5078 4..148 CDD:227410 93/143 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 196 1.000 Domainoid score I690
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 216 1.000 Inparanoid score I928
OMA 1 1.010 - - QHG53976
OrthoFinder 1 1.000 - - FOG0002236
OrthoInspector 1 1.000 - - otm47146
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1478
TreeFam 1 0.960 - -
1110.930

Return to query results.
Submit another query.