DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and Ube2e3

DIOPT Version :10

Sequence 1:NP_609715.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_033480.1 Gene:Ube2e3 / 22193 MGIID:107412 Length:207 Species:Mus musculus


Alignment Length:142 Identity:65/142 - (45%)
Similarity:83/142 - (58%) Gaps:0/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RIIKETQRLLEDPVPGISATPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAPKVRF 71
            ||.||...:..||.|..||.|...|...:...:.||..|.:|||.|.|::....|||.|.|||.|
Mouse    65 RIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTF 129

  Fly    72 LTKIFHPNIDRVGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAELWKVNERRA 136
            .|:|:|.||:..|.||||||||.|||||.|..|||||.:||:..||.|||...:|..:..|....
Mouse   130 RTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEH 194

  Fly   137 IQLARECTLKHA 148
            .::||:.|.::|
Mouse   195 DRIARQWTKRYA 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_609715.1 UBCc_UBE2N 4..147 CDD:467433 64/139 (46%)
Ube2e3NP_033480.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63
UBCc_UBE2E 64..204 CDD:467413 64/138 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.