DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and Ube2e2

DIOPT Version :10

Sequence 1:NP_609715.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_017171445.1 Gene:Ube2e2 / 218793 MGIID:2384997 Length:239 Species:Mus musculus


Alignment Length:156 Identity:65/156 - (41%)
Similarity:84/156 - (53%) Gaps:14/156 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RIIKETQRLLEDPVP--------------GISATPDECNARYFHVLVTGPKDSPFEGGNFKLELF 57
            ||.||...:..||.|              .:||.|...|...:...:.||..|.:|||.|.|::.
Mouse    83 RIQKELAEITLDPPPNCRHMFYDSKWVPEALSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDIT 147

  Fly    58 LPEDYPMKAPKVRFLTKIFHPNIDRVGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLA 122
            ...|||.|.|||.|.|:|:|.||:..|.||||||||.|||||.|..|||||.:||:..||.|||.
Mouse   148 FSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLV 212

  Fly   123 NDVAELWKVNERRAIQLARECTLKHA 148
            ..:|..:..|.....::||:.|.::|
Mouse   213 GSIATQYMTNRAEHDRMARQWTKRYA 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_609715.1 UBCc_UBE2N 4..147 CDD:467433 64/153 (42%)
Ube2e2XP_017171445.1 UBCc_UBE2E 82..236 CDD:467413 64/152 (42%)

Return to query results.
Submit another query.