DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and Ube2d1

DIOPT Version :9

Sequence 1:NP_001285937.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_006513541.1 Gene:Ube2d1 / 216080 MGIID:2384911 Length:160 Species:Mus musculus


Alignment Length:142 Identity:68/142 - (47%)
Similarity:91/142 - (64%) Gaps:0/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IIKETQRLLEDPVPGISATPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAPKVRFL 72
            |.||...|..||....||.|...:..::...:.||.||.::||.|.|.:..|.|||.|.||:.|.
Mouse    19 IQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFT 83

  Fly    73 TKIFHPNIDRVGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAELWKVNERRAI 137
            |||:||||:..|.||||||:.:|||||.:..|||||.:||..|||||||..|:|:::|.::.:..
Mouse    84 TKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYN 148

  Fly   138 QLARECTLKHAM 149
            :.|||.|.|:||
Mouse   149 RHAREWTQKYAM 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_001285937.1 UBCc 3..151 CDD:294101 68/142 (48%)
COG5078 7..149 CDD:227410 66/140 (47%)
Ube2d1XP_006513541.1 UBCc 19..159 CDD:381827 66/139 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.