DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and ubc-22

DIOPT Version :10

Sequence 1:NP_609715.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_509501.2 Gene:ubc-22 / 182322 WormBaseID:WBGene00006717 Length:182 Species:Caenorhabditis elegans


Alignment Length:97 Identity:26/97 - (26%)
Similarity:51/97 - (52%) Gaps:9/97 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 FHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAPKVRFLTKIFHPNID-RVGRICLDILKDKWSPA 98
            ||  :.||.|:|:|.|.|:::|..|::||...|:::|.|.|::..:: ..|::.:    :.:| .
 Worm    33 FH--IAGPADTPYETGVFEVDLTFPDNYPNALPQIKFQTLIWNCAVEPSTGQVHI----ENYS-R 90

  Fly    99 LQIRTVLLSIQALLSAPNPDDP-LANDVAELW 129
            |.:...|..|:.|..:...|:. :....|..|
 Worm    91 LNVSEALSYIEDLFRSIEVDEEVMFYKTARFW 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_609715.1 UBCc_UBE2N 4..147 CDD:467433 26/97 (27%)
ubc-22NP_509501.2 UBCc_UEV 21..107 CDD:467407 23/80 (29%)
UBA_like_SF 139..174 CDD:473871
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.