DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and ubc-21

DIOPT Version :9

Sequence 1:NP_001285937.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_509502.3 Gene:ubc-21 / 182321 WormBaseID:WBGene00006716 Length:214 Species:Caenorhabditis elegans


Alignment Length:119 Identity:52/119 - (43%)
Similarity:74/119 - (62%) Gaps:1/119 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ALTPRIIKETQRLLEDPVPGISATPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAP 67
            |...|..||.....:....||.....|.|.......:.||:.:|:.||.|::::.:||.||.:.|
 Worm    21 ARVTRKCKEVANASDITEAGIHVEIKENNLMDIKGFIKGPEGTPYAGGTFEIKVDIPEHYPFEPP 85

  Fly    68 KVRFLTKIFHPNI-DRVGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDP 120
            |.:|:|:|:|||| .:.|.||||||||||:.:|.:||||||:||:|.:|.|.||
 Worm    86 KAKFVTRIWHPNISSQTGTICLDILKDKWTASLTLRTVLLSLQAMLCSPEPSDP 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_001285937.1 UBCc 3..151 CDD:294101 52/119 (44%)
COG5078 7..149 CDD:227410 51/115 (44%)
ubc-21NP_509502.3 COG5078 15..167 CDD:227410 52/119 (44%)
UQ_con 25..163 CDD:278603 51/115 (44%)
UBA_II_E2_UBE2K_like 178..213 CDD:270498
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.