DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and ubc-21

DIOPT Version :10

Sequence 1:NP_609715.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_509502.3 Gene:ubc-21 / 182321 WormBaseID:WBGene00006716 Length:214 Species:Caenorhabditis elegans


Alignment Length:119 Identity:52/119 - (43%)
Similarity:74/119 - (62%) Gaps:1/119 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ALTPRIIKETQRLLEDPVPGISATPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAP 67
            |...|..||.....:....||.....|.|.......:.||:.:|:.||.|::::.:||.||.:.|
 Worm    21 ARVTRKCKEVANASDITEAGIHVEIKENNLMDIKGFIKGPEGTPYAGGTFEIKVDIPEHYPFEPP 85

  Fly    68 KVRFLTKIFHPNI-DRVGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDP 120
            |.:|:|:|:|||| .:.|.||||||||||:.:|.:||||||:||:|.:|.|.||
 Worm    86 KAKFVTRIWHPNISSQTGTICLDILKDKWTASLTLRTVLLSLQAMLCSPEPSDP 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_609715.1 UBCc_UBE2N 4..147 CDD:467433 51/118 (43%)
ubc-21NP_509502.3 UBCc_UBE2K 20..165 CDD:467420 52/119 (44%)
UBA_II_E2_UBE2K_like 178..213 CDD:270498
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.