DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and ubc-18

DIOPT Version :9

Sequence 1:NP_001285937.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_498541.1 Gene:ubc-18 / 175985 WormBaseID:WBGene00006713 Length:153 Species:Caenorhabditis elegans


Alignment Length:122 Identity:47/122 - (38%)
Similarity:74/122 - (60%) Gaps:2/122 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAPKVRFLTKIFHPNIDRVGRICLDIL- 91
            :|.|...:.||:. |...|:..|.||:.:..|.|||.|.|||.|.|||:|||:|..|:.||.|: 
 Worm    28 EETNLLKWTVLLI-PDKEPYNKGAFKVGITFPVDYPFKPPKVAFETKIYHPNVDEEGKFCLPIVT 91

  Fly    92 KDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAELWKVNERRAIQLARECTLKHA 148
            .:.|.||.:...|::::.:|::.|.|..|:..||||.::.:.::.::.|.|.|.|||
 Worm    92 AENWKPATKTEQVMMALLSLINEPEPSHPIRADVAEEFQKDHKKFMKTAEEHTRKHA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_001285937.1 UBCc 3..151 CDD:294101 47/122 (39%)
COG5078 7..149 CDD:227410 47/122 (39%)
ubc-18NP_498541.1 UBCc 4..144 CDD:238117 43/116 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.