DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and ubc-20

DIOPT Version :10

Sequence 1:NP_609715.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_497174.1 Gene:ubc-20 / 175185 WormBaseID:WBGene00006715 Length:199 Species:Caenorhabditis elegans


Alignment Length:100 Identity:49/100 - (49%)
Similarity:69/100 - (69%) Gaps:3/100 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VTGPKDSPFEGGNFKLELFLPEDYPMKAPKVRFLTKIFHPNI-DRVGRICLDILKDKWSPALQIR 102
            :.||.|:|:.||.|.|::.:|:.||...|.|:|.|||:|||: .:.|.||||||||:|:.:|.:|
 Worm    43 IRGPPDTPYAGGMFDLDIKIPDQYPFSPPNVKFSTKIWHPNVSSQTGVICLDILKDQWAASLTLR 107

  Fly   103 TVLLSIQALLSAPNPDDPLANDVAELWKVNERRAI 137
            |||||||||:..|.|.||....||:.:.  |:.|:
 Worm   108 TVLLSIQALMCTPEPKDPQDAVVAKQYM--EKPAV 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_609715.1 UBCc_UBE2N 4..147 CDD:467433 49/99 (49%)
ubc-20NP_497174.1 UBCc_UBE2K 6..151 CDD:467420 49/99 (49%)
UBA_II_E2_UBE2K_like 163..198 CDD:270498
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.