DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and ubc-16

DIOPT Version :9

Sequence 1:NP_001285937.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_493587.1 Gene:ubc-16 / 173354 WormBaseID:WBGene00006711 Length:152 Species:Caenorhabditis elegans


Alignment Length:116 Identity:38/116 - (32%)
Similarity:63/116 - (54%) Gaps:4/116 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ALTPRIIKETQRLLEDPVPG--ISATPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMK 65
            |.|.|::||..:|..:...|  :..|....:.:.:.:.|.|.:.:.:.|..|.|:......||..
 Worm     4 AATRRLMKELAQLKSEAPEGLLVDNTSTSNDLKQWKIGVVGAEGTLYAGEVFMLQFTFGPQYPFN 68

  Fly    66 APKVRFLTKIF--HPNIDRVGRICLDILKDKWSPALQIRTVLLSIQALLSA 114
            :|:|.|:.:..  ||:|...|.|||.||.|.|:|||.:::|.|||.::||:
 Worm    69 SPEVMFVGETIPAHPHIYSNGHICLSILSDDWTPALSVQSVCLSILSMLSS 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_001285937.1 UBCc 3..151 CDD:294101 38/116 (33%)
COG5078 7..149 CDD:227410 36/112 (32%)
ubc-16NP_493587.1 UQ_con 8..>110 CDD:365926 30/101 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.