DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and UBE2F

DIOPT Version :10

Sequence 1:NP_609715.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_542409.1 Gene:UBE2F / 140739 HGNCID:12480 Length:185 Species:Homo sapiens


Alignment Length:142 Identity:46/142 - (32%)
Similarity:71/142 - (50%) Gaps:17/142 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AALTPRIIKETQRLLEDPVPGISAT---------PDECNARYFHVLVTGPKDSPFEGGNFKLELF 57
            |:.:.|.:....:||...|..:.|.         ||......|.:.|| |.:..::||.|:.|..
Human    23 ASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVT-PDEGYYQGGKFQFETE 86

  Fly    58 LPEDYPMKAPKVRFLTKIFHPNIDRVGRICLDILKDK------WSPALQIRTVLLSIQALLS-AP 115
            :|:.|.|..|||:.||||:||||...|.|||.:|::.      |:|...::.|:..:.:|.: ..
Human    87 VPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLL 151

  Fly   116 NPDDPLANDVAE 127
            |.||||..:.||
Human   152 NFDDPLNIEAAE 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_609715.1 UBCc_UBE2N 4..147 CDD:467433 45/140 (32%)
UBE2FNP_542409.1 Interaction with UBA3. /evidence=ECO:0000269|PubMed:19250909 1..29 1/5 (20%)
UBCc_UBE2F_UBE2M 32..176 CDD:467414 44/133 (33%)

Return to query results.
Submit another query.