DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and birc6

DIOPT Version :9

Sequence 1:NP_001285937.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_031758792.1 Gene:birc6 / 100135722 XenbaseID:XB-GENE-1001894 Length:4834 Species:Xenopus tropicalis


Alignment Length:132 Identity:42/132 - (31%)
Similarity:65/132 - (49%) Gaps:30/132 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QRLLEDPVPGISATP-----------DECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKA 66
            :||.::.|...::.|           ||.......||:|||.|:|:..|.|:.:::.|:|||...
 Frog  4553 RRLAQEAVTLSTSLPLSSSSSVFVRCDEERLDIMKVLITGPADTPYANGCFEFDVYFPQDYPNSP 4617

  Fly    67 PKVRFLTK-----IFHPNIDRVGRICLDIL-------KDKWSPA----LQIRTVLLSIQALLSAP 115
            |.|...|.     .|:||:...|::||.||       ::||:|.    ||   ||:|||:|:...
 Frog  4618 PLVNLETTGGHSVRFNPNLYNDGKVCLSILNTWHGRPEEKWNPQTSSFLQ---VLVSIQSLILVS 4679

  Fly   116 NP 117
            .|
 Frog  4680 EP 4681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_001285937.1 UBCc 3..151 CDD:294101 42/132 (32%)
COG5078 7..149 CDD:227410 42/132 (32%)
birc6XP_031758792.1 BIR 240..313 CDD:237989
BIRC6 3442..3597 CDD:403536
UBCc 4574..4686 CDD:238117 38/111 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.